10dB, 20db EDFA multi-canal-canal senzill guanyar Block fibra Edfa Raman d'entrada amplificador òptic

10dB, 20db EDFA multi-canal-canal senzill guanyar Block fibra Edfa Raman d'entrada amplificador òptic

Descripció del producte SP5100 sèrie és un amplificador òptic CATV reforç amb la banda de l'espectre de guany a 1540 ~ 1565nm.

Function
Productdescription
SP5100seriesisaCATVboosteropticalamplifierwithgainspectrumbandwithin1540 ~ 1565nm. Thiskindofopticalamplifierisdesignedfortheapplicationofsinglechannelor1~8continuousribbonchannels(ITUwavelength). Generally,fiberCATVsystemoperatesinsinglewavelengththathasnostrictrequirementongainflatness.HA5100 boosteramplifierisfeaturedwithlowNF, saturatedoutputpower alt. Itisapplicableforcentralbureau, sots-bureauandlinerelay, aswellasotheropticalcommunicationnetwork. HA5100isappliedmostcommonlyandwidelycomparedwithotheropticalamplifierinCATVsystem.
sopoisthefamousmanufacturerofopticalamplifier. HA5100opticalamplifieradoptstheworldand#39;stopclasspumplaserandAmericaOFSerbium-dopedopticalfiber.PerfectAPC,ACCandATCcontrol,excellentdesignintheventilationandheat-dissipationensurethelonglifeandhighreliableworkofpumplaser. RS232andRJ45offerserialcommutationandSNMPnetworkmanagementport.TheLCDatthefrontpanelofferstheworkindexofallequipmentandwarningalarm.Thelaserwillswitchoffautomaticallyifopticalpowerismissing,whichofferssecurityprotectionforthelaser. Alltheopticalportofopticalamplifiercanbeinstalledinthefrontpanel(alsocanbeinthebackpanelifcustomersspecify).
producte sopo, foritshighquality, highreliableandhighcostperformance, istheidealchoiceofthesystemintegrationandsystemoperation.
Productfeatures
1540 ~ 1563nmoperatingwavelength
Lownoise, highoutput, highreliability
APC,ACC,ATCcontrolledselection(HA5100/P)
PowerfulRS232supervisoryinstruction
Threeexterioroption:1U(19"stander), 3D (12.4", 3U, escriptori-tipus) andmodulator
1Uand3Dexterior, offeringstatusappearanceanddiagnosingfaultwithLCD, standardRS232communicationinterface, SNMPnetworkmanagementfunction
Applicationof3Dmodelstoadapttolaboratory
ExcellentP/Pratio
Mainapplication
AMCATV
DigitalCATV
DBSandamp; MMDS
FTTP
FTTxPON
Laboratoryapplication
Applicationcases
255KmPAL-D/56CHandamp; 20CHDigitalQAMHybridTransmissionApplicationCases
587KmpuredigitalTV1550nmoverlengthopticaltrunkapplicationCases
TheapplicationofHA5100insatelliteL-Bandlong-distance(816Km) fibertransmission
Opto-electricaldiagram
OpticalportmodeM4(withinputandamp;outputmonitorport)

OpticalportmodeO4(fourwaysopticaloutput)

Amplificador òptic del EDFA multicanal guany bloc està dissenyat per reunir-se baix soroll i guanyar requisits planitud de

Divisió de longitud d'ona dens multiplexació de sistema. (Sistema DWDM). Està disponible en diversos tipus de clients triar,

incloent reforç amplificador, amplificador de línia i pre amplificador. Perquè l'amplificador òptic isTelcordia GR-1312-CORE qualificat i

RoHS Acomodatici, els clients poden sentir segurs a adquirir-lo.

Característiques

1. alta producció de potència, gran fiabilitat

2. petita grandària, fàcil instal·lació

3. ampli operatiu longituds d'ona

SopofiberismultichannelopticalamplifiermanufacturerinChina, weoffermultichannelopticalamplifier, andopticalperformance

Monitor,portablePONopticalpowermeter, wesupplyhighqualitywithcompetitiveprice, ourcompanyisbasedonChina,

cadena completa de manufacturingmini òptica interruptor, Acoplador de fibra monomode arbre banda ampla es pot completar a la Xina, fins i tot en una ciutat.

Menor cost de fabricació estalvia el cost de compra. Com més detalls de cada producte es mostren a la pàgina amb Descripció.


Amplificador òptic Raman està especialment dissenyada per a sistema de transmissió òptica de llarg termini.

Directament es pot amplificar els senyals òptics de banda C, L-banda i banda C L i milloraria

senyal òptic a proporció de soroll (OSNR), millorant així el rendiment de transmissió del sistema.

L'amplificador òptic pot millorar el sistema existent a 10Gb/s o 40Gb/s. A més,

és Telcordia GR-1312-CORE qualificat i RoHS Acomodatici, donant clients total tranquil • litat.

Característiques
1. estructura compacta, baix consum d'energia
2. d'alt guany, guany bo planitud
3. alt rendiment bomba làser i dispositiu passiu

Sopofiber és Raman amplificador òptic fabricant a la Xina, oferim amplificador òptic Raman,

i OEO convertidor, portàtil atenuador variable òptic, subministrem d'alta qualitat amb preu competitiu,

la nostra empresa es basa en Xina, Cadena completa de fabricació elèctrica atenuador variable òptica,

Acoplador de banda ampla fibra monomode es pot completar a la Xina, fins i tot en una ciutat.

Menor cost de fabricació estalvia el cost de compra.

Com més detalls de cada producte es mostren a la pàgina amb la descripció

Amplificadors òptics EDFA-MW/GW-VGA està especialment dissenyada per a sistema de transmissió DWDM.

EDFA-MW és Optoelectrònics integrat mòdul i pur mòdul òptic EDFA-GW.

Com amplificador òptic Sopofiber és Telcordia GR-1312-CORE qualificat i RoHS Acomodatici,

Els clients poden sentir segurs en el seu ús.

Característiques
1. ajustable guany disseny permet l'amplificador òptic donar cabuda a una gran varietat de condicions d'operació flexible
2. mitja etapa accés per DCM, OADM
3. alt producció baix, potència de soroll
4. dóna suport a mode ACC o AGC
5. estàndard interfície RS232 comunicació
6. precisió control alta, característica de la bona resposta a transitoris
7. gran fiabilitat, baix consum energètic

Sopofiber és fabricant de amplificadors òptics EDFA - VGA a la Xina, oferim amplificadors òptics EDFA - VGA,

mòdul MEMS atenuador matriu, Acoplador de longitud d'ona especial, subministrem d'alta qualitat amb preu competitiu,

la nostra empresa es basa en Xina, Cadena completa de fabricació convertidor DWDM OEO, multicanal FBG DCM

mòdul es pot completar a la Xina, fins i tot en una ciutat. Menor cost de fabricació estalvia el cost de compra.

Com més detalls de cada producte es mostren a la pàgina amb Descripció.


Amplificadors òptics EDFA-TV és especialment dissenyats i fabricats per sistema CATV.Que s'instal·la darrere l'òptic

transmissor d'augmentar la potència del transmissor iallargar la distància de transmissió de senyal.

L'amplificador òptic és Telcordia GR-1312-COREqualificat i RoHS aprovat.

Característiques
1. alt producció baix, potència de soroll
2. tot operant longituds d'ona, cobrint tota la C-banda
3. gran fiabilitat
4. interfície de control flexible
5. estàndard bastidor CATV, fàcil d'instal·lar i mantenir

Aplicacions
Amplificadors òptics EDFA-TV és adequat per xarxa CATV analògic i xarxa de distribució de fibra òptica.
Sopofiber és fabricant amplificador òptic a la Xina, oferim amplificador òptic i manual atenuador variable òptica,

Separador PLC, subministrem alta qualitat amb preu competitiu, la nostra empresa es basa en Xina,

cadena completa de fabricació monitor òptic línia, mòdul d'FBG DCM multicanal es pot completar en Xina,

fins i tot en una ciutat. Menor cost de fabricació estalvia el cost de compra. Com més detalls de cada producte

es mostren a la pàgina amb Descripció.

Amplificadors òptics EDFA-PA és un amplificador de baix soroll que està especialment dissenyada per a single canal òpticsistema de transmissió.

S'instal·la davant del receptor per millorar la sensibilitat d'auricular i ampliar la distància de transmissió de senyal.

Com és l'amplificador òptic Telcordia GR-1312-CORE qualificat i satisfà necessitats de RoHS,

Els clients poden sentir a gust en la seva compra.

Característiques
1. alt guany òptic, la figura de baix soroll, bon ASE inhibició funció
2. alta fiabilitat, preu competitiu
3. interfície de control flexible
4. ampli operatiu longituds d'ona
5. control disponibles de xarxa
6. estàndard cremallera de fàcil instal·lació i manteniment

Aplicacions
Amplificadors òptics EDFA-PA és àmpliament utilitzat per la xarxa d'àrea metropolitana, xarxa d'accés,
xarxa de llarg termini,

i diversos tipus de sistemes de transmissió SDH/PDH. Accelink és l'amplificador òpticfabricant a la Xina,

Oferim amplificador òptic i l'atenuador òptica fixa,Acoplador de longitud d'ona especial,Subministrem d'alta qualitat amb

preu competitiu,la nostra empresa es basa en Xina,cadena completa de fabricació mòdul FBG DCM conducte,

línia òptic, protector d'equips es pot completar a la Xina, fins i tot en una ciutat. Fabricació inferiorcost estalvia

el seu cost de compra.Com més detalls de cada producte es mostren a la pàgina amb Descripció.

Amplificadors òptics EDFA-LA és un amplificador de línia especialment dissenyat per al sistema de transmissió òptica de conducte.

Instal·lat en la línia de transmissió, l'amplificador òptic pot compensar la pèrdua de potència òptica i prolongar la

transmissió de senyals a distància. Això fa que l'elecció ideal per reemplaçar regeneradora O-E-O convencional.

A més, l'amplificador òptic és Telcordia GR-1312-CORE qualificat i RoHS acomodaticis, així que si us plau fóssiu

segura en adquirir-lo.

Característiques
1. amplificadors òptics EDFA-LA és més rendible i fiables que els productes similars.
2. facilitat d'ús, baix nivell de soroll
3. interfície de control flexible
4. control disponibles de xarxa
5. estàndard bastidor, fàcil d'instal·lar i mantenir

Aplicacions
Amplificador òptic Sopofiber és ideal per a llarg termini xarxa, xarxa d'àrea metropolitana, xarxa d'accés,

sistemes de transmissió, així com diversos SDH/PDH.

Sopofiber és fabricant amplificador òptic a la Xina, oferim amplificador òptic i mini interruptor òptica,

Acoplador de fibra monomode arbre de banda ampla, subministrem alta qualitat amb preu competitiu, la nostra empresa

es basa en Xina, Cadena completa de fabricació PD TAP, AIXETA PD matriu mòdul, monitor de rendiment òptic

es pot completar a la Xina, fins i tot en una ciutat. Menor cost de fabricació estalvia el cost de compra.

Com més detalls de cada producte es mostren a la pàgina amb la descripció

Amplificadors òptics EDFA-BA és un amplificador de reforç especialment dissenyat per al sistema de transmissió òptica de conducte.

Que s'instal·la darrere el transmissor a augmentar la potència del transmissor i estendre el senyal òptic

distància de transmissió. L'amplificador òptic és Telcordia GR-1312-CORE qualificat i satisfà necessitats de RoHS.

A causa del nostre enfocament constant en la millora del producte, Sopofiber amplificador òptic té molts avantatges, com ara
1. alt producció baix, potència de soroll
2. tot operant longituds d'ona, cobrint tota la C-banda
3. completa i seguiment interfície flexible
4. Independent control disponibles de la xarxa
5. alta fiabilitat
6. estàndard bastidor, fàcil d'instal·lar i mantenir

Aplicacions
Amplificadors òptics EDFA-BA és adequat per al llarg termini xarxa, xarxa d'àrea metropolitana, xarxa d'accés, així com diversos sistemes de transmissió SDH/PDH.
Sopofiber és fabricant amplificador òptic a la Xina, oferim amplificador òptic i canvi d'òptica, Acoplador de banda ampla fibra monomode, subministrem d'alta qualitat amb preu competitiu, la nostra empresa es basa en Xina, Cadena completa de fabricació coaxial PD coaxial mòdul de matriu de PD, mesurador de potència òptica multicanal es pot completar a la Xina, fins i tot en una ciutat. Menor cost de fabricació estalvia el cost de compra. Com més detalls de cada producte es mostren a la pàgina amb Descripció.

Amplificador de mòdul de guany conducte EDFA òptic està especialment dissenyada per a sistema de transmissió òptica de conducte de banda C.

L'amplificador òptic ve en diversos tipus. El tipus compacte EDFA-MD és el tipus general i EDFA-MC. El mòdul pot

ser utilitzat per fer EDFA targeta o bastidor, muntatge, segons customerand #39; requisits específics de s.

Amplificador de mòdul de guany conducte Sopofiber òptic és Telcordia GR-1312-CORE qualificat i RoHS Acomodatici. Com és fiable,

fàcil d'instal·lar i ve amb interfície de control flexible, és cada vegada més utilitzat a llarg termini xarxa, xarxa d'àrea metropolitana,

xarxa d'accés, així com diversos sistemes de transmissió SDH/PDH.

Sopofiber és fabricant amplificador òptic a la Xina, oferim amplificador òptic i elèctrica atenuador variable òptica,

Acoplador de banda ampla fibra monomode, subministrem alta qualitat amb preu competitiu, la nostra empresa es basa en Xina,

completa la cadena de fabricació convertidor OEO, mòdul de fibra de compensació de dispersió es pot completar en Xina,

fins i tot en una ciutat. Menor cost de fabricació estalviael seu cost de compra.

Com més detalls de cada producte es mostren a la pàgina amb Descripció.

EDFAsinglechannelgainblockopticalamplifierisdesignedforuseinsinglechannelopticaltransmissionsystem.Byapplication,

thisproductcanbedividedintoboosteramplifier, lineamplifierandpreamplifier.

Yearsoffocusonproductimprovementhasresultedintheopticalamplifierhavingmanyadvantages, suchascompactstructure,

highoutputpower, lownoiseandgreatreliability. Asaresult, SopofiberopticalamplifierisTelcordiaGR1312CORE, RoHSqualified,

andisverypopularwithcustomersaroundtheworld.

Aplicacions


EDFAsinglechannelgainblockopticalamplifieriswidelyappliedinmetropolitanareanetwork, accessnetworkandCATVsystem,

inadditiontosinglechannelopticaltransmissionsystem.

SopofiberissinglechannelopticalamplifiermanufacturerinChina, weoffersinglechannelopticalamplifier, andmultichannelopticalpowermeter,opticalpowermeter,wesupplyhighqualitywithcompetitiveprice, ourcompanyisbasedonChina, fullchainofmanufacturingopticalswitch,

singlemodebroadbandfibercouplercanbecompletedinChina, eveninonecity. Lowermanufacturingcostsavesyourpurchasingcost.

Themoredetailsofeachproductareshownthepagewithdescription

Amplificador òptic de mòdul de guany de banda EDFA L està dissenyat especialment per satisfer banda L DWDMand #39; requisits s en termes de banda ampla,

baix soroll, guany planitud i guanyar pany. Inclou reforç amplificador, amplificador de línia i pre amplificador. El mòdul es pot utilitzar per

fer EDFA targeta o muntar cremallera. Com el producte és de Telcordia GR-1312-CORE qualificat i RoHS Acomodatici, els clients poden sentir-se

assegurar en la seva compra.

Amb les característiques d'interfície de seguiment flexible, mida compacta i fàcil instal·lació, banda L EDFA guanyar amplificador òptic mòdul

és àmpliament utilitzat en banda L transmissió òptica sistema i banda L DWDM.

Sopofiber és fabricant amplificador òptic a la Xina, oferim amplificador òptic i protector de línia/equipament òptica, òptic font de llum,

Subministrem d'alta qualitat amb preu competitiu, la nostra empresa es basa en Xina, Cadena completa de fabricació atenuador òptica fixa,

Acoplador especial longitud d'ona es pot completar a la Xina, fins i tot en una ciutat.

Menor cost de fabricació estalvia el cost de compra. Com més detalls de cada producte es mostren a la pàgina amb Descripció.

10 dBm sortida únic canal impulsor EDFA amplificador òptic per a xarxes SDH
Amplificador SDH-EDFA-BA-O6 impulsor dissenyat per a les aplicacions de jerarquia Digital síncrona (SDH) que s'instal·la després el transmissor per augmentar la distància de transmissió per sola longitud d'ona òptica mòdul sistema òptic. El mecanisme presenta van poder d'amplada entrada des - 10dBm a + 6dBm, poder de producció fins a 10dBm i baix soroll. També inclou interfície d'ordinador RS-232.

Aquest amplificador en bastidor Rack treball per defecte en mode senyal guany constant, però es pot configurar per constant mode de producció de potència total. Aquestes unitats són utilitzades en aplicacions de transmissió llarg transporta, especialment per la PDH, SDH, SONET i aplicació de transmissió Ethernet òptica. Seva facilitat d'ús i rendiment fer la sèrie SDH-EDFA-BA-xx la solució ideal per a xarxes òptiques accés i Metro.

Característiques
• Servei com un amplificador de reforç C-Band 1550nm
• Sintonitzable potència de sortida: 10dBm
• Tot el poder interval d'entrada: -10 ~ + 6dBm
• Baixa loise figura: típica isandlt; 4.5dB
• Connectors: connectors SC/UPC, SC/APC, FC/UPC, FC/APC, LC/UPC, LC/APC, ST/UPC i ST/APC estan disponibles
• Ús individual o doble 110VAC, 220 VAC., - 48VDC, o l'ordre de 100V-240V d'alimentació
• Interfície serial ve amb RS232, RS485
• 1U 19andquot; estructura de muntar cremallera per a instal·lació fàcil
• Encàrrec de tota actuació compatible amb BellcoreGR-1312-CORE
• Utilització per a xarxes òptiques accés i Metro
• Treballa amb aplicacions de punt a punt
• Alta estabilitat i fiabilitat
• 3 anys de garantia
• 10 anys de vida d'operació
• L'OEM és disponible
Subratlla
• Intercanvi calenta xarxa Agent d'administració
Interfície de direcció de xarxa SNMP •: RJ45
• Suport Telnet per a opcional
• ASE soroll filtre andamp; Filtres de supressió d'ASE
• Alta Circuit precisa ACC (corrent automàtica constant) com omissió, si vostè necessita altres circuits, contacteu a sales@fiberstore.com
• Funció ATC (control de temperatura automàtic)
• Oferir l'aparició de l'estat i diagnòstic de fallades amb LCD
L'estructura mecànica

Exemple d'estructura

NOTA:
L'SDH EDFA de Fiberstore com 1 + 2 + 3.

Especificacions

Paràmetres

Símbol

Min

Typ

Max

Unitat

Longitud d'ona operació

Λc

1530

1550

1562

nm

Poder de producció saturat (1)

PO

20

dBm

Potència d'entrada (2)

Pi

-35

6

dBm

Guany

G

20

32

dB

Figura de soroll

NF

4.5

dB

Aïllament d'entrada

ISOi

30

dB

Aïllament de sortida

ISOo

30

dB

Fuites de la bomba d'entrada

Rica

-35

dBm

Fuita de sortida de la bomba

PumpLout

-45

-45

dBm

Pèrdua retorn

RL

-45

dB

Guany dependents de polarització

PDG

0.3

dB

PMD

PMD

0.5

PD

Temperatura d'operació

TW

-5

60

Temperatura d'emmagatzematge

TS

-40

80

Humitat (3)

10

85

%

Tensió d'alimentació

VPS

85/170

110/220

132/264

VAC

Consum d'energia

P

18

W

Interfície Serial

RS232, RS485

Font d'alimentació

110VAC, 220 VAC, - 48VDC o ordre de 100V-240V

Connectors de

Simple SC/UPC, SC/APC, FC/UPC, FC/APC, LC/UPC, LC/APC, ST/UPC i ST/APC disponible

Garantia

3 anys

(1): client opcional
(2): pre-amplificador: aportació poder –35 ~-25dBm; Inline-amplificador: aportació poder –25 ~-10dBm, impulsor: aportació poder –10 ~ + 6dBm
(3): no hi ha condensació

Guanyar 20dB canal senzill EDFA pre-amplificador amplificador òptic per a xarxes SDH
Pre-amplificador SDH-EDFA-PA-G20 dissenyat per a les aplicacions de jerarquia Digital síncrona (SDH) són conducte EDFA instal ╖ lats abans de l'auricular per millorar la sensibilitat receptora i ampliar la distància de transmissió de senyal. El mecanisme presenta van poder d'amplada entrada des - 35dBm al - 25dBm, guany 20dB i baix soroll. També inclou interfície d'ordinador RS-232.

Aquest amplificador en bastidor Rack treball per defecte en mode senyal guany constant, però es pot configurar per constant mode de producció de potència total. Aquestes unitats són utilitzades en aplicacions de transmissió llarg transporta, especialment per la PDH, SDH, SONET i aplicació de transmissió Ethernet òptica. Seva facilitat d'ús i rendiment fer la sèrie SDH-EDFA-PA-xx la solució ideal per a xarxes òptiques accés i Metro.
Característiques
• Servei com un pre-amplificador banda C 1550nm
• Guany: 20dB
• Tot el poder interval d'entrada:-35dBm al - 25dBm
• Baixa loise figura: típica isandlt; 4.5dB
• Connectors: connectors SC/UPC, SC/APC, FC/UPC, FC/APC, LC/UPC, LC/APC, ST/UPC i ST/APC estan disponibles
• Ús individual o doble 110VAC, 220 VAC., - 48VDC, o l'ordre de 100V-240V d'alimentació
• Interfície serial ve amb RS232, RS485
• 1U 19andquot; estructura de muntar cremallera per a instal·lació fàcil
• Encàrrec de tota actuació compatible amb BellcoreGR-1312-CORE
• Utilització per a xarxes òptiques accés i Metro
• Treballa amb aplicacions de punt a punt
• Alta estabilitat i fiabilitat
• 3 anys de garantia
• 10 anys de vida d'operació
• L'OEM és disponible
Subratlla
• Intercanvi calenta xarxa Agent d'administració
Interfície de direcció de xarxa SNMP •: RJ45
• Suport Telnet per a opcional
• ASE soroll filtre andamp; Filtres de supressió d'ASE
• Alta Circuit precisa ACC (corrent automàtica constant) com omissió, si vostè necessita altres circuits, contacteu a sales@fiberstore.com
• Funció ATC (control de temperatura automàtic)
• Oferir l'aparició de l'estat i diagnòstic de fallades amb LCD
L'estructura mecànica

Exemple d'estructura

NOTA:
L'SDH EDFA de Fiberstore com 1 + 2 + 3.

Especificacions

Paràmetres

Símbol

Min

Typ

Max

Unitat

Longitud d'ona operació

Λc

1530

1550

1562

nm

Poder de producció saturat (1)

PO

20

dBm

Potència d'entrada (2)

Pi

-35

6

dBm

Guany

G

20

32

dB

Figura de soroll

NF

4.5

dB

Aïllament d'entrada

ISOi

30

dB

Aïllament de sortida

ISOo

30

dB

Fuites de la bomba d'entrada

Rica

-35

dBm

Fuita de sortida de la bomba

PumpLout

-45

-45

dBm

Pèrdua retorn

RL

-45

dB

Guany dependents de polarització

PDG

0.3

dB

PMD

PMD

0.5

PD

Temperatura d'operació

TW

-5

60

Temperatura d'emmagatzematge

TS

-40

80

Humitat (3)

10

85

%

Tensió d'alimentació

VPS

85/170

110/220

132/264

VAC

Consum d'energia

P

18

W

Interfície Serial

RS232, RS485

Font d'alimentació

110VAC, 220 VAC, - 48VDC o ordre de 100V-240V

Connectors de

Simple SC/UPC, SC/APC, FC/UPC, FC/APC, LC/UPC, LC/APC, ST/UPC i ST/APC disponible

Garantia

3 anys

(1): client opcional
(2): pre-amplificador: aportació poder –35 ~-25dBm; Inline-amplificador: aportació poder –25 ~-10dBm, impulsor: aportació poder –10 ~ + 6dBm
(3): no hi ha condensació

EDFAmulti-channelgainmoduleopticalamplifierisdesignedfordensewavelengthdivisionmultiplexingsystem(DWDMsystem).

Theopticalamplifierisavailableinseveraltypes.

EDFA's-MWisthegeneraltypeandEDFA-MCisthecompacttype.Accordingtocustomerand #39; srequirements, themodulecanbeused

tomakeEDFAcardorrackmount.

Featuringsmallsize, lownoise, easyinstallationandhighreliability, EDFAmulti-channelgainmoduleopticalamplifierisTelcordia

GR-1312-CORE, RoHSqualified, andisincreasinglyusedinDWDM, METROsystems.

SopofiberissinglechannelopticalamplifiermanufacturerinChina, weoffersinglechannelopticalamplifier, andMEMSvariable

opticalattenuator, singlemodebroadbandtreefibercoupler, wesupplyhighqualitywithcompetitiveprice, ourcompanyisbased

onChina, fullchainofmanufacturingbidirectionalOEOconverter, singlechannelFBGDCMmodulecanbecompletedinChina,

eveninonecity. Lowermanufacturingcostsavesyourpurchasingcost.

Themoredetailsofeachproductareshownthepagewithdescription.

Amplificador òptic d'alta potència de Sopofiber és un producte dissenyat per a aplicacions d'òptica accés FTTH/CATV.
Gràcies a l'ús de Sopofiber Er-IB bombada revestit co-dopats amb tecnologia d'amplificador de fibra, la potència total pot ser fins a 33 dBm.

Característiques
1. Wideoperatingwavelengthrange
2.Lownoise, convenientinstallationandmaintenance
3.Standard2Urackmount, multipleoutputlevels
4. Flexiblemonitoringinterface

Aplicacions
SopofiberhighpoweropticalamplifiercanbeusedindifferentFTTH/PONapplications.

SopofiberishighpoweropticalamplifiermanufacturerinChina, weofferhighpoweropticalamplifier, andbidirectionalOEO

Convertidor,benchtopdigitalvariableopticalattenuator, wesupplyhighqualitywithcompetitiveprice,ourcompanyisbased

onChina, fullchainofmanufacturingMEMSvariableopticalattenuator, singlemodebroadbandtreefibercouplercanbe

completedinChina, eveninonecity. Lowermanufacturingcostsavesyourpurchasingcost.Themoredetailsofeachproduct

areshownthepagewithdescription.



Aprofitant l'àmplia experiència i coneixements, SOPO és conegut com un dels majors fabricants de 10db, 20db edfa multicanal canal únic guany bloc fibra edfa amplificador d'entrada raman òptic per a la seva alta qualitat i productes de baix preu i un servei excel·lent. Si us plau, ser lliure comprar productes barats fets la Xina de la fàbrica.

Hot Tags: 10dB, 20db edfa multicanal-canal senzill guanyar bloc edfa de fibra òptica raman aportació fabricants amplificador, fàbrica, fet a la Xina, qualitat, preu, barats
Productes relacionats
Contacti amb nosaltres
SOPO Optical Communication Co., Ltd

Adreça: JinDiDa Industry Zone, Langkou Industry Pak, Dalang Street, Longhua New District, Shenzhen, Xina

Telèfon: +86-755-23124132

Enviar per fax: 86-755-23774378

Correu electrònic: 18818523155@163.com

SOPO Optical Communication Co., Ltd
foottop